Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
GNAQ antibody Western blot. All lanes: Anti GNAQ at 0.5 ug/ml. Lane 1: Rat Ovary Tissue Lysate at 50 ug. Lane 2: Rat Testis Tissue Lysate at 50 ug. Lane 3: Mouse Testis Tissue Lysate at 50 ug. Lane 4: 22RV1 Whole Cell Lysate at 40 ug. Lane 5: SKOV Whole Cell Lysate at 40 ug. Predicted band size: 42 kD. Observed band size: 42 kD.
GNAQ Antibody (aa102-138)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Bovine, Dog, Guinea Pig, Hamster, Horse, Human, Mammal (Other), Mouse, Pig, Rat, Sheep |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407919-100
Catalog Number: LS-C407919
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GNAQ antibody LS-C407919 is an unconjugated rabbit polyclonal antibody to GNAQ (aa102-138) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Bov, Can, GP, Ham, Hr, Hu, Mml, Ms, Por, Rt, Sh
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GNAQ | G-ALPHA-q | GAQ
- UniProt Number
- P50148
- NCBI GenBank
- NM_002072 | NP_002063.2
- SwissProt
- P50148
Target
- Target
- Human GNAQ
- Antigen Species
- Human
- Epitope
- Predominantly expressed in ovary, prostate, testis and colon. Down-regulated in the peripheral blood lymphocytes (PBLs) of rheumatoid arthritis patients (at protein level). .
- Gene Name
- GNAQ
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human GNAQ (102-138 aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
