Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
GLP2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay |
| Reactivity: | Human |
| Format: | Lyophilized |
$521.00each
Catalog Number: LS-C129258-20
Catalog Number: LS-C129258
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GLP2 antibody LS-C129258 is an unconjugated rabbit polyclonal antibody to human GLP2. Validated for ELISA.
- Application
- ELISA
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Recommended Dilution: ELISA
- 1:3000
Target
- Target
- Human GLP2
- Antigen Species
- Human
- Epitope
- Recognizes human Glucagon like Peptide-2.
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- Synthetic human GLP-2, KLH-conjugated (HADGSFSDEMNTILDNLAARDFINWLIQTKITD). Percent identity by BLAST analysis: Human, Gorilla, Marmoset (100%); Gibbon, Rat, Guinea pig (97%); Monkey, Mouse, Hamster (94%); Elephant, Horse (90%); Sheep, Panda, Dog, Bovine, Pig (87%); Opossum (81%).
- Immunogen Type
- Synthetic Immunogen
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, pH 7.2
- Volume
- 20 Microliter
- Preservative
- No
- Purification Method
- Unpurified (Serum / Ascites / Supernatant)
Storage & Handling
- Storage Conditions
- Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.
- Recommended Storage Buffer
- PBS
