Western blot testing of 1) rat kidney and 2) mouse kidney lysate with Connexin 32 antibody at 0.5ug/ml. Predicted molecular weight ~32 kDa.
GJB1 / CX32 / Connexin 32 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782090-100
Catalog Number: LS-C782090
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Connexin 32 antibody LS-C782090 is an unconjugated rabbit polyclonal antibody to Connexin 32 (GJB1 / CX32) from mouse. It is reactive with mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Ms, Rt
- Predicted Reactivity
- Human
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Connexin 32 | CMTX1 | Connexin-32 | CX32 | Gap junction beta-1 protein | Gap junction protein beta-1 | CMTX | GJB1
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P08034
- NCBI GenBank
- BC022426 | NP_000157.1
- SwissProt
- P08034
Target
- Target
- Mouse GJB1 / CX32 / Connexin 32
- Antigen Species
- Mouse
- Gene Name
- GJB1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids AMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVH were used as the immunogen for the Connexin 32 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS