Western blot analysis of extracts of various cell lines, using GJB1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
GJB1 / CX32 / Connexin 32 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C496823-20
Catalog Number: LS-C496823
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Connexin 32 antibody LS-C496823 is an unconjugated rabbit polyclonal antibody to Connexin 32 (GJB1 / CX32) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Connexin 32 | CMTX1 | Connexin-32 | CX32 | Gap junction beta-1 protein | Gap junction protein beta-1 | CMTX | GJB1
- Recommended Dilution: WB
- 1:200 - 1:1000
- UniProt Number
- P08034
- NCBI GenBank
- BC022426 | NP_000157.1
- SwissProt
- P08034
Target
- Target
- Human GJB1 / CX32 / Connexin 32
- Antigen Species
- Human
- Gene Name
- GJB1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 214-283 of human GJB1 (NP_000157.1). IRACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS