
Western blot analysis of extracts of various cell lines.
GJA4 / CX37 / Connexin 37 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C332143-20
Catalog Number: LS-C332143
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Connexin 37 antibody LS-C332143 is an unconjugated rabbit polyclonal antibody to human Connexin 37 (GJA4 / CX37). Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Connexin-37 | Gap junction protein alpha 4 | Gap junction alpha-4 protein | GJA4 | Connexin 37 | CX37
- UniProt Number
- P35212
- NCBI GenBank
- NM_002060 | NP_002051.2
- SwissProt
- P35212
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 1:500 - 1:2000 |
Target
- Target
- Human GJA4 / CX37 / Connexin 37
- Antigen Species
- Human
- Epitope
- Human GJA4 / CX37 / Connexin 37
- Gene Name
- GJA4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 229-333 of human GJA4 (NP_002051.2). VHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
