
GJA3 antibody Western blot. All lanes: Anti GJA3 at 0.5 ug/ml. Lane 1: Rat Cardiac Muscle Tissue Lysate at 50 ug. Lane 2: Rat Kidney Tissue Lysate at 50 ug. Lane 3: Human Placenta Tissue Lysate at 50 ug. Lane 4: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 47 kD. Observed band size: 55 kD.
GJA3 / CX46 / Connexin 46 Antibody (aa89-118)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407808-100
Catalog Number: LS-C407808
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Connexin 46 antibody LS-C407808 is an unconjugated rabbit polyclonal antibody to Connexin 46 (GJA3 / CX46) (aa89-118) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Connexin-46 | CX46 | CZP3 | Gap junction alpha-3 protein | Gap junction protein alpha 3 | GJA3 | CAE3 | Connexin 46
- UniProt Number
- Q9Y6H8
- NCBI GenBank
- NM_021954 | NP_068773.2
- SwissProt
- Q9Y6H8
Target
- Target
- Human GJA3 / CX46 / Connexin 46
- Antigen Species
- Human
- Gene Name
- GJA3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human GJA3 (89-118 aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE), different from the related mouse and rat sequences by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
