Western blot analysis of extract of various cells.

GFRA2 Antibody

Name: GFRA2 Antibody
Brand: LSBio
SKU: LS-C408614-20
Price: 281 USD
Availability: InStock

$281.00each

Catalog Number: LS-C408614-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: GFRA2 antibody LS-C408614 is an unconjugated rabbit polyclonal antibody to GFRA2 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: GDNF receptor alpha-2 | GDNFRB | GFR-alpha 2 | GFR-alpha-2 | GDNF family receptor alpha-2 | GDNFR-beta | GFRA2 | GDNF family receptor alpha 2 | Neurturin receptor alpha | RET ligand 2 | TRNR2 | TRN receptor, GPI-anchored | NTNR-alpha | NTNRA | GDNF receptor beta | GDNFR-alpha-2 | NRTNR-ALPHA | RETL2
Recommended Dilution: WB: 1:200 - 1:2000
UniProt Number: O00451
NCBI GenBank: NM_001495 | NP_001486.4
SwissProt: O00451

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 360-464 of human GFRA2 (NP_001486.4). DVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)