IHC testing of FFPE human breast cancer tissue with GFI1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.

GFI1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry, Paraffin
Reactivity:	Human
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782099-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: GFI1 antibody LS-C782099 is an unconjugated rabbit polyclonal antibody to human GFI1. Validated for IHC.
Application: IHC-P
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Growth factor independence-1 | GFI-1 | GFI1A | SCN2 | Zinc finger protein 163 | Zinc finger protein Gfi-1 | ZNF163 | GFI1 | Growth factor independent 1
Recommended Dilution: IHC-P: 1 - 2 µg/ml
UniProt Number: Q99684
NCBI GenBank: NM_005263 | NP_005254.2
SwissProt: Q99684

Target

Target: Human GFI1
Antigen Species: Human
Gene Name: GFI1

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH were used as the immunogen for the GFI1 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS