Western blot analysis of extracts of various cell lines, using GDNF antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 60s.

GDNF Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C749634-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: GDNF antibody LS-C749634 is an unconjugated rabbit polyclonal antibody to GDNF from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: HSCR3 | GDNF | HFB1-GDNF | ATF | HGDNF
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: P39905
NCBI GenBank: NM_000514 | NP_000505.1
SwissProt: P39905

Target

Target: Human GDNF
Antigen Species: Human
Gene Name: GDNF

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 109-211 of human GDNF (NP_000505.1). RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)