
GAL4 / Galectin 4 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490659-100
Catalog Number: LS-C490659
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Galectin 4 antibody LS-C490659 is an unconjugated rabbit polyclonal antibody to human Galectin 4 (GAL4). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Antigen NY-CO-27 | GAL4 | Galectin 4 | L36LBP | L-36 lactose-binding protein | Gal-4 | Galectin-4 | Lactose-binding lectin 4 | LGALS4
- UniProt Number
- P56470
- NCBI GenBank
- NM_006149 | NP_006140.1
- SwissProt
- P56470
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human GAL4 / Galectin 4
- Antigen Species
- Human
- Gene Name
- LGALS4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY were used as the immunogen for the GAL4 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
