Western blot - Anti-GADD45A/Gadd 45Alpha Picoband Antibody
GADD45A / GADD45 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662416-100
Catalog Number: LS-C662416
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GADD45 antibody LS-C662416 is an unconjugated rabbit polyclonal antibody to human GADD45 (GADD45A). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GADD45A | DDIT-1 | DDIT1 | GADD45
- UniProt Number
- P24522
- NCBI GenBank
- NM_001924 | NP_001915.1
- SwissProt
- P24522
Target
- Target
- Human GADD45A / GADD45
- Antigen Species
- Human
- Gene Name
- GADD45A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human GADD45A (125-165 aa VLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLP ER), identical to the related mouse and rat sequences.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl