GADD45A / GADD45 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490651-100
Catalog Number: LS-C490651
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GADD45 antibody LS-C490651 is an unconjugated rabbit polyclonal antibody to human GADD45 (GADD45A). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GADD45A | DDIT-1 | DDIT1 | GADD45
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P24522
- NCBI GenBank
- NM_001924 | NP_001915.1
- SwissProt
- P24522
Target
- Target
- Human GADD45A / GADD45
- Antigen Species
- Human
- Gene Name
- GADD45A
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids VLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER were used as the immunogen for the GADD45A antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS