
Western blot analysis of extracts of various cell lines.
GABRR1 / GABA(A) Receptor rho- Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C334256-20
Catalog Number: LS-C334256
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- GABA(A) Receptor rho- antibody LS-C334256 is an unconjugated rabbit polyclonal antibody to GABA(A) Receptor rho- (GABRR1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- GABRR1 | GABA(A) receptor subunit rho-1 | GABA(A) receptor, rho 1 | GABA(C) receptor | Gaba(c) receptor rho-1 subunit
- UniProt Number
- P24046
- NCBI GenBank
- NM_002042 | NP_002033.2
- SwissProt
- P24046
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC | 1:50 - 1:200 |
| WB | 1:500 - 1:2000 |
Target
- Target
- Human GABRR1 / GABA(A) Receptor rho
- Antigen Species
- Human
- Epitope
- Human GABRR1
- Gene Name
- GABRR1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 365-465 of human GABRR1 (NP_002033.2). VNYLTTVQERKEQKLREKLPCTSGLPPPRTAMLDGNYSDGEVNDLDNYMPENGEKPDRMMVQLTLASERSSPQRKSQRSSYVSMRIDTHAIDKYSRIIFPA
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
