Western blot analysis of GAA expression in rat liver extract (lane 1) and A549 whole cell lysates (lane 2). GAA at 70KD was detected using rabbit anti-GAA Antigen Affinity purified polyclonal antibody at 0.5 µg/mL. The blot was developed using chemiluminescence (ECL) method.
GAA / Alpha-Glucosidase, Acid Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C661892-100
Catalog Number: LS-C661892
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Alpha-Glucosidase, Acid antibody LS-C661892 is an unconjugated rabbit polyclonal antibody to human Alpha-Glucosidase, Acid (GAA). Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Acid maltase | Aglucosidase alfa | Glucosidase, alpha | Lysosomal alpha-glucosidase | Glucosidase, alpha acid | LYAG | GAA
- UniProt Number
- P10253
- NCBI GenBank
- NM_000152 | NP_000143.2
- SwissProt
- P10253
Target
- Target
- Human GAA / Alpha-Glucosidase, Acid
- Antigen Species
- Human
- Gene Name
- GAA
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527 aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl