Western blot - Anti-Frizzled 4 Picoband antibody
FZD4 / Frizzled 4 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662745-100
Catalog Number: LS-C662745
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Frizzled 4 antibody LS-C662745 is an unconjugated rabbit polyclonal antibody to human Frizzled 4 (FZD4). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CD344 | CD344 antigen | EVR1 | FZD4 | Frizzled family receptor 4 | Frizzled-4 | Fz-4 | Fz4 | HFz4 | Exudative vitreoretinopathy 1 | FEVR | FZD4S | FzE4 | Frizzled 4 | Frizzled homolog 4 | WNT receptor frizzled-4
- UniProt Number
- Q9ULV1
- NCBI GenBank
- NM_012193 | NP_036325.2
- SwissProt
- Q9ULV1
Target
- Target
- Human FZD4 / Frizzled 4
- Antigen Species
- Human
- Epitope
- Almost ubiquitous. Largely expressed in adult heart, skeletal muscle, ovary, and fetal kidney. Moderate amounts in adult liver, kidney, pancreas, spleen, and fetal lung, and small amounts in placenta, adult lung, prostate, testis, colon, fetal brain and liver.
- Gene Name
- FZD4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl