Western blot testing of 1) human HepG2, 2) human K562 and 3) mouse NIH3T3 cell lysate with FUS antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa but routinely observed at ~75 kDa.
FUS / TLS Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782030-100
Catalog Number: LS-C782030
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TLS antibody LS-C782030 is an unconjugated rabbit polyclonal antibody to TLS (FUS) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 75 kDa DNA-pairing protein | ALS6 | CHOP | FUS-CHOP | FUS1 | Fused in sarcoma | HnRNP-P2 | FUS | HNRNPP2 | Oncogene TLS | RNA-binding protein FUS | TLS | C/EBP-homologous protein | ETM4 | Fus-like protein | Oncogene FUS | POMP75
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P35637
- NCBI GenBank
- NM_004960 | NP_004951.1
- SwissProt
- P35637
Target
- Target
- Human FUS / TLS
- Antigen Species
- Human
- Gene Name
- FUS
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT were used as the immunogen for the FUS antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS