
Western blot - Anti-TLS / FUS Picoband Antibody
FUS / TLS Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662023-100
Catalog Number: LS-C662023
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TLS antibody LS-C662023 is an unconjugated rabbit polyclonal antibody to human TLS (FUS). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 75 kDa DNA-pairing protein | ALS6 | CHOP | FUS-CHOP | FUS1 | Fused in sarcoma | HnRNP-P2 | FUS | HNRNPP2 | Oncogene TLS | RNA-binding protein FUS | TLS | C/EBP-homologous protein | ETM4 | Fus-like protein | Oncogene FUS | POMP75
- UniProt Number
- P35637
- NCBI GenBank
- NM_004960 | NP_004951.1
- SwissProt
- P35637
Target
- Target
- Human FUS / TLS
- Antigen Species
- Human
- Epitope
- Ubiquitous.
- Gene Name
- FUS
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
