
FTH1 / Ferritin Heavy Chain Antibody (Preservative Free)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay |
| Reactivity: | Human |
| Format: | Lyophilized |
$247.00each
Catalog Number: LS-C149208-20
Catalog Number: LS-C149208
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Ferritin Heavy Chain antibody LS-C149208 is an unconjugated rabbit polyclonal antibody to human Ferritin Heavy Chain (FTH1). Validated for ELISA.
- Application
- ELISA
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Apoferritin | Ferritin H subunit | Ferritin heavy chain | Ferritin, heavy polypeptide 1 | FHC | FTHL6 | PIG15 | PLIF | FTH | FTH1
- UniProt Number
- P02794
- NCBI GenBank
- NM_002032 | NP_002023.2
- SwissProt
- P02794
Recommended Dilution
| Application | Dilution |
|---|---|
| ELISA | 1:20000 |
Target
- Target
- Human FTH1 / Ferritin Heavy Chain
- Antigen Species
- Human
- Epitope
- The antibody can specifically bind to its immunogen, and did not show any cross reactivity with unrelated antigens in ELISA. The specificity for binding to recombinant protein, cellular protein and native antigen is not defined. Cross reactivity with mouse and rat Ferritin has not yet been tested.
- Gene Name
- FTH1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Synthetic peptide derived from human Ferritin. Immunogen Sequence: CRAKNKIAKETNNKKKEFEETAEKVRCNSLVNLYLQASYTYLSLGFYFDR.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, No preservatives added
- Preservative
- No
- Purification Method
- Protein A/G Affinity
Storage & Handling
- Storage Conditions
- Short term: Store at 4°C for up to 1 month. Long term: Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
