IL21 Receptor Antibody
Catalog Number: LS-C487537-100
100 µL / $309.00
Antibody: Rabbit Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay
Reactivity: Human
Format: Liquid
Western blot analysis of extracts of various cell lines, using FSHR antibody.
FSH Receptor / FSHR Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C331489-20
Catalog Number: LS-C331489
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- FSHR antibody LS-C331489 is an unconjugated rabbit polyclonal antibody to FSHR (FSH Receptor) from human. It is reactive with human and mouse. Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FSHRO | FSHR | Ovarian dysgenesis 1 | FSH receptor | FSH-R | LGR1 | ODG1
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P23945
- NCBI GenBank
- NM_000145 | NP_000136.2
- SwissProt
- P23945
Target
- Target
- Human FSH Receptor / FSHR
- Antigen Species
- Human
- Epitope
- Human FSH Receptor / FSHR
- Gene Name
- FSHR
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 631-695 of human FSHR (NP_000136.2). KNFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTSGSTYILVPLSHLAQN
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
