Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
FOXA3 antibody Western blot. All lanes: Anti FOXA3 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Pancreas Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 37 kD. Observed band size: 37 kD.
FOXA3 Antibody (aa291-324)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408016-100
Catalog Number: LS-C408016
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- FOXA3 antibody LS-C408016 is an unconjugated rabbit polyclonal antibody to FOXA3 (aa291-324) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FOXA3 | Forkhead box A3 | HNF-3G | HNF3G | HNF-3-gamma | Forkhead box protein A3 | TCF3G | TCF-3G | FKHH3 | Transcription factor 3G
- UniProt Number
- P55318
- NCBI GenBank
- NM_004497 | NP_004488.2
- SwissProt
- P55318
Target
- Target
- Human FOXA3
- Antigen Species
- Human
- Epitope
- Expressed in erythroleukemia and hepatoma cell lines and in liver and pancreas. Not expressed in any other cell lines or tissues examined. .
- Gene Name
- FOXA3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human FOXA3 (291-324 aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
