Human Apolipoprotein H Antibody (IgA) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67373-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
FMO1 antibody Western blot. All lanes: Anti FMO1 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: Rat Kidney Tissue Lysate at 50 ug. Lane 4: Mouse Kidney Tissue Lysate at 50 ug. Lane 5: SMMC Whole Cell Lysate at 40 ug. Predicted band size: 60 kD. Observed band size: 60 kD.
FMO1 Antibody (aa334-363)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Pig, Rabbit, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407802-100
Catalog Number: LS-C407802
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- FMO1 antibody LS-C407802 is an unconjugated rabbit polyclonal antibody to FMO1 (aa334-363) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Por, Rb, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Dimethylaniline oxidase 1 | FMO1 | FMO 1
- UniProt Number
- Q01740
- NCBI GenBank
- NM_002021 | NP_002012.1
- SwissProt
- Q01740
Target
- Target
- Human FMO1
- Antigen Species
- Human
- Epitope
- Expressed mainly in fetal liver, adult kidney and, to a lesser extent, the intestine.
- Gene Name
- FMO1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human FMO1 (334-363 aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
