Polyclonal Rabbit anti-Human FLVCR2 Antibody (aa329-378, WB)
Catalog Number: LS-C152167-100
100 µL (0.5 mg/mL) / $433.00
Antibody: Rabbit Polyclonal
Applications: Western Blot
Reactivity: Human
Format: Liquid
Western blot analysis of extracts of various cells.
FLVCR2 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C409364-20
Catalog Number: LS-C409364
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- FLVCR2 antibody LS-C409364 is an unconjugated rabbit polyclonal antibody to FLVCR2 from human. It is reactive with human and mouse. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C14orf58 | Calcium-chelate transporter | CCT | FLVCR2 | FLVCRL14q | EPV | PVHH | MFSD7C
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9UPI3
- NCBI GenBank
- NM_017791, NP_060261.2
- SwissProt
- Q9UPI3
Target
- Target
- Human FLVCR2
- Antigen Species
- Hu
- Epitope
- Human FLVCR2
- Gene Name
- FLVCR2
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FLVCR2 (NP_060261.2). MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQPSGLAHPSSSGPEDLSVIKVSRRRWAVVLVFSCYSMCNSF
- Immunogen Type
- Fusion-P
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
