
FLT3LG / Flt3 Ligand Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490264-100
Catalog Number: LS-C490264
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Flt3 Ligand antibody LS-C490264 is an unconjugated rabbit polyclonal antibody to Flt3 Ligand (FLT3LG) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FL | Flt3 ligand | FLT3LG | FLT3L | SL cytokine
- UniProt Number
- P49771
- NCBI GenBank
- NM_001459 | NP_001450.2
- SwissProt
- P49771
Recommended Dilution
| Application | Dilution |
|---|---|
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human FLT3LG / Flt3 Ligand
- Antigen Species
- Human
- Gene Name
- FLT3LG
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK of human Flt3 ligand were used as the immunogen for the Flt3 ligand antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
