Western blot testing of 1) rat kidney, 2) mouse liver and 3) mouse HEPA1-6 lysaste with VEGF Receptor 1 antibody at 0.5ug/ml. Predicted molecular weight ~150 kDa.
FLT1 / VEGFR1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782844-100
Catalog Number: LS-C782844
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- VEGFR1 antibody LS-C782844 is an unconjugated rabbit polyclonal antibody to VEGFR1 (FLT1) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FLT | FLT-1 | Fms-related tyrosine kinase 1 | SFlt1 | VEGF-r1 | VEG-R1 | Tyrosine-protein kinase FRT | VEGFR-1 | FLT1 | Fms-like tyrosine kinase 1 | FRT | VEGF receptor 1 | VEGFf-rI | VEGFR1
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P17948
- NCBI GenBank
- NM_002019 | NP_002010.2
- SwissProt
- P17948
Target
- Target
- Human FLT1 / VEGFR1
- Antigen Species
- Human
- Gene Name
- FLT1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids DPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKE from the human protein were used as the immunogen for the VEGF Receptor 1 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS