
Western blot analysis of extracts of HeLa cells.
FLNB / TAP Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C335245-20
Catalog Number: LS-C335245
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TAP antibody LS-C335245 is an unconjugated rabbit polyclonal antibody to TAP (FLNB) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ABP-280 | ABP-280 homolog | AOI | ABP-278 | Actin binding protein 278 | Actin-binding-like protein | Filamin homolog 1 | FLN1L | FLN3 | FH1 | Filamin-3 | FLNB | LRS1 | TAP | Thyroid autoantigen | Beta-filamin | Filamin B, beta | Filamin-B | FLN-B | TABP | Truncated ABP
- UniProt Number
- O75369
- NCBI GenBank
- NM_001457 | NP_001448.2
- SwissProt
- O75369
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC | 1:20 - 1:50 |
| WB | 1:500 - 1:1000 |
Target
- Target
- Human FLNB / TAP
- Antigen Species
- Human
- Epitope
- Human FLNB / TAP
- Gene Name
- FLNB
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1686-1785 of human FLNB (NP_001157789.1). PDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFA
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
