Western blot analysis of extracts of various cell lines.

FLI1 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunofluorescence, Immunohistochemistry (general), Immunoprecipitation, Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C335594-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: FLI1 antibody LS-C335594 is an unconjugated rabbit polyclonal antibody to human FLI1. Validated for IF, IHC, IP and WB.
Application: IF, IHC, IP, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: FLI-1 | FLI1 | EWSR2 | SIC-1 | Proto-oncogene Fli-1 | Transcription factor ERGB | Fli-1 oncogene
Recommended Dilution: IF/ICC: 1:50 - 1:100
Recommended Dilution: IHC: 1:50 - 1:200
Recommended Dilution: IP: 1:50 - 1:200
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q01543
NCBI GenBank: NM_002017 | NP_002008.2
SwissProt: Q01543

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FLI1 (NP_002008.2). MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPM
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)