
IHC analysis of FH using anti-FH antibody. FH was detected in paraffin-embedded section of rat liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml mouse anti-FH Antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
FH / Fumarase / MCL Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Non-Human Primate, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C756652-100
Catalog Number: LS-C756652
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- MCL antibody LS-C756652 is an unconjugated mouse monoclonal antibody to MCL (FH / Fumarase) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, NHP, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- FH | Fumarase | Fumarate hydratase | MCUL1 | HLRCC | LRCC | MCL
- UniProt Number
- P07954
- NCBI GenBank
- NM_000143 | NP_000134.2
- SwissProt
- P07954
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 0.5 - 1 µg/ml |
| WB | 0.1 - 0.5 µg/ml |
Target
- Target
- Human FH / Fumarase / MCL
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- FH
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Isotype
- IgG2a
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAH KNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl
