Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot testing of 1) human COLO-320, 2) rat brain and 3) mouse brain lysate with FGF9 antibody at 0.5ug/ml. Predicted molecular weight ~23 kDa.
FGF9 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782151-100
Catalog Number: LS-C782151
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- FGF9 antibody LS-C782151 is an unconjugated rabbit polyclonal antibody to FGF9 from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FGF-9 | FGF9 | HBFG-9 | Fibroblast growth factor 9 | Glia-activating factor | SYNS3 | GAF | HBGF-9
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P31371
- NCBI GenBank
- NM_002010 | NP_002001.1
- SwissProt
- P31371
Target
- Target
- Human FGF9
- Antigen Species
- Human
- Gene Name
- FGF9
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY were used as the immunogen for the FGF9 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
