Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
FGF9 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C756543-100
Catalog Number: LS-C756543
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- FGF9 antibody LS-C756543 is an unconjugated rabbit polyclonal antibody to FGF9 from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FGF-9 | FGF9 | HBFG-9 | Fibroblast growth factor 9 | Glia-activating factor | SYNS3 | GAF | HBGF-9
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P31371
- NCBI GenBank
- NM_002010 | NP_002001.1
- SwissProt
- P31371
Target
- Target
- Human FGF9
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- FGF9
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human FGF9 (DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
- Recommended Storage Buffer
- NaCl
