Western blot analysis of extracts of various cell lines, using FGF7 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
FGF7 / KGF Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C496739-20
Catalog Number: LS-C496739
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- KGF antibody LS-C496739 is an unconjugated rabbit polyclonal antibody to human KGF (FGF7). Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FGF-7 | Fibroblast growth factor- 7 | Keratinocyte growth factor | FGF7 | Fibroblast growth factor 7 | HBGF-7 | KGF
- Recommended Dilution: WB
- 1:500 - 1:1000
- UniProt Number
- P21781
- NCBI GenBank
- NM_002009, NP_002000.1
- SwissProt
- P21781
Target
- Target
- Human FGF7 / KGF
- Antigen Species
- Hu
- Gene Name
- FGF7
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 32-95 of human FGF7 (NP_002000.1). CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNY
- Immunogen Type
- Fusion-P
Format
- Conjugate/Label
- Unconj
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS