
Western blot - Anti-FGB/Fibrinogen Picoband Antibody
FGB / Fibrinogen Beta Chain Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662076-100
Catalog Number: LS-C662076
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Fibrinogen Beta Chain antibody LS-C662076 is an unconjugated rabbit polyclonal antibody to human Fibrinogen Beta Chain (FGB). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FGB | Fibrinogen, B beta polypeptide | Fibrinogen beta chain
- UniProt Number
- P02675
- NCBI GenBank
- NM_005141 | NP_005132.2
- SwissProt
- P02675
Target
- Target
- Human FGB / Fibrinogen Beta Chain
- Antigen Species
- Human
- Epitope
- Detected in blood plasma (at protein level). .
- Gene Name
- FGB
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225 aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
