
IHC testing of FFPE human tonsil tissue with FDCSP antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
FDC-SP / C4orf7 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782006-100
Catalog Number: LS-C782006
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- C4orf7 antibody LS-C782006 is an unconjugated rabbit polyclonal antibody to human C4orf7 (FDC-SP). Validated for IHC.
- Application
- IHC-P
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C4orf7 | FDC secreted protein | FDCSP | FDC-SP
- Recommended Dilution: IHC-P
- 1 - 2 µg/ml
- UniProt Number
- Q8NFU4
- SwissProt
- Q8NFU4
Target
- Target
- Human FDC-SP / C4orf7
- Antigen Species
- Human
- Gene Name
- FDCSP
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids 18-51 (FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR) from the human protein were used as the immunogen for the FDCSP antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
