Immunohistochemistry - Anti-FDCSP Picoband Antibody
FDC-SP / C4orf7 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662282-100
Catalog Number: LS-C662282
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- C4orf7 antibody LS-C662282 is an unconjugated rabbit polyclonal antibody to human C4orf7 (FDC-SP). Validated for IHC.
- Application
- IHC, IHC-P
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C4orf7 | FDC secreted protein | FDCSP | FDC-SP
- UniProt Number
- Q8NFU4
- SwissProt
- Q8NFU4
Target
- Target
- Human FDC-SP / C4orf7
- Antigen Species
- Human
- Epitope
- Abundantly expressed in tonsil, lymph node, and trachea; strong expression in prostate; lower expression in thyroid, stomach, and colon. .
- Gene Name
- FDCSP
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51 aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl