
Western blot analysis of extracts of various cell lines, using FAM117B antibody.
FAM117B / ALS2CR13 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C335368-20
Catalog Number: LS-C335368
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ALS2CR13 antibody LS-C335368 is an unconjugated rabbit polyclonal antibody to ALS2CR13 (FAM117B) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ALS2CR13 | FAM117B | Protein FAM117B
- UniProt Number
- Q6P1L5
- NCBI GenBank
- NM_173511 | NP_775782.2
- SwissProt
- Q6P1L5
Target
- Target
- Human FAM117B / ALS2CR13
- Antigen Species
- Human
- Epitope
- Human FAM117B / ALS2CR13
- Gene Name
- FAM117B
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 293-372 of human FAM117B (NP_775782.2). SKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDI
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
