liver FABP antibody Western blot. All lanes: Anti liver FABP at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: SMMC Whole Cell Lysate at 40 ug. Lane 4: HEPG2 Whole Cell Lysate at 40 ug. Lane 5: RH35 Whole Cell Lysate at 40 ug. Predicted band size: 14 kD. Observed band size: 14 kD.
FABP1 / L-FABP Antibody (aa6-36)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407799-100
Catalog Number: LS-C407799
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- L-FABP antibody LS-C407799 is an unconjugated rabbit polyclonal antibody to L-FABP (FABP1) (aa6-36) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- FABP1 | FABPL | L-FABP | Fatty acid-binding protein 1
- UniProt Number
- P07148
- NCBI GenBank
- NM_001443 | NP_001434.1
- SwissProt
- P07148
Target
- Target
- Human FABP1 / L-FABP
- Antigen Species
- Human
- Gene Name
- FABP1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human liver FABP (6-36 aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.01 mg NaN3
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl