Western blot testing of human plasma with Factor V antibody at 0.5ug/ml. Predicted molecular weight ~252 kDa.
F5 / Factor Va Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782120-100
Catalog Number: LS-C782120
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Factor Va antibody LS-C782120 is an unconjugated rabbit polyclonal antibody to human Factor Va (F5). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Activated protein C cofactor | F5 | Factor V Leiden | FVL | Factor Va | RPRGL1 | THPH2 | Coagulation factor V | PCCF | Proaccelerin, labile factor
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P12259
- NCBI GenBank
- NM_000130 | NP_000121.2
- SwissProt
- P12259
Target
- Target
- Human F5 / Factor Va
- Antigen Species
- Human
- Gene Name
- F5
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids ESTVMATRKMHDRLEPEDEESDADYDYQNRLAAALGIR from the human protein were used as the immunogen for the Factor V antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS