Immunoprecipitation analysis of 200ug extracts of HT-29 cells, using 3 ug EZH2 antibody. Western blot was performed from the immunoprecipitate using EZH2 antibody at a dilition of 1:1000.

EZH2 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunoprecipitation, Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C748887-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: EZH2 antibody LS-C748887 is an unconjugated rabbit polyclonal antibody to human EZH2. Validated for IP and WB.
Application: IP, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ENX1 | Enhancer of zeste homolog 2 | EZH2 | KMT6 | KMT6A | Lysine N-methyltransferase 6 | WVS2 | Enhancer of zeste | ENX-1
Recommended Dilution: IP: 1:50 - 1:100
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q15910
NCBI GenBank: NM_004456 | NP_004447.2
SwissProt: Q15910

Target

Target: Human EZH2
Antigen Species: Human
Gene Name: EZH2

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human EZH2 (NP_001190176.1). LERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELI
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)