
EWSR1 antibody Western blot. All lanes: Anti EWSR1 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Testis Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Lane 4: SKOV Whole Cell Lysate at 40 ug. Lane 5: SW620 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 95 kD.
EWSR1 / EWS Antibody (aa369-399)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407797-100
Catalog Number: LS-C407797
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- EWS antibody LS-C407797 is an unconjugated rabbit polyclonal antibody to EWS (EWSR1) (aa369-399) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EWS | RNA-binding protein EWS | BK984G1.4 | EWS oncogene | EWSR1
- UniProt Number
- Q01844
- NCBI GenBank
- NM_005243 | NP_005234.1
- SwissProt
- Q01844
Target
- Target
- Human EWSR1 / EWS
- Antigen Species
- Human
- Epitope
- Ubiquitous.
- Gene Name
- EWSR1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399 aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
