Western blot - Anti-ErbB 4 Picoband antibody
ERBB4 / HER4 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662623-100
Catalog Number: LS-C662623
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HER4 antibody LS-C662623 is an unconjugated rabbit polyclonal antibody to human HER4 (ERBB4). Validated for IHC and WB.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ERBB 4 | HER4 | p180 erb4 | p180erbB4 | ERBB4
- UniProt Number
- Q15303
- NCBI GenBank
- NM_005235 | NP_005226.1
- SwissProt
- Q15303
Target
- Target
- Human ERBB4 / HER4
- Antigen Species
- Human
- Epitope
- Expressed at highest levels in brain, heart, kidney, in addition to skeletal muscle, parathyroid, cerebellum, pituitary, spleen, testis and breast. Lower levels in thymus, lung, salivary gland, and pancreas. Isoform JM-A CYT-1 and isoform JM-B CYT-1 are expressed in cerebellum, but only the isoform JM-B is expressed in the heart.
- Gene Name
- ERBB4
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human ErbB 4 (SLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLR).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl