IHC testing of FFPE human prostate cancer tissue with EpCAM antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.

EPCAM Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Enzyme-Linked Immunosorbent Assay, Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$587.00each

Catalog Number: LS-C781860-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: EPCAM antibody LS-C781860 is an unconjugated rabbit polyclonal antibody to human EPCAM. Validated for ELISA, IHC and WB.
Application: ELISA, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: 323/A3 | ACSTD1 | 17-1A | CD326 | EGP | EGP34 | Epithelial glycoprotein | GA733-2 | HNPCC8 | Ep-CAM | ESA | HEGP314 | KS 1/4 antigen | KS1/4 | KSA | M1S2 | MIC18 | MK-1 | MH99 | TROP1 | TACST-1 | TACSTD1 | CD326 antigen | CO-17A | DIAR5 | EGP-2 | EGP314 | EGP40 | EPCAM | Epithelial glycoprotein 314 | HEA125 | Ly74 | M4S1
Recommended Dilution: ELISA: 0.5 - 1 ug/ml
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: P16422
NCBI GenBank: NM_002354 | NP_002345.2
SwissProt: P16422

Immunogen: Amino acids 147-189 (ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN) from the human protein were used as the immunogen for the EpCAM antibody.

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS