Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
EPCAM was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- EPCAM Antigen Affinity purified polyclonal antibody
EPCAM Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Enzyme-Linked Immunosorbent Assay, Flow Cytometry, Immunocytochemistry, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C661885-100
Catalog Number: LS-C661885
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- EPCAM antibody LS-C661885 is an unconjugated rabbit polyclonal antibody to human EPCAM. Validated for ELISA, Flow, ICC, IHC and WB.
- Application
- ELISA, FC, ICC, IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 323/A3 | ACSTD1 | 17-1A | CD326 | EGP | EGP34 | Epithelial glycoprotein | GA733-2 | HNPCC8 | Ep-CAM | ESA | HEGP314 | KS 1/4 antigen | KS1/4 | KSA | M1S2 | MIC18 | MK-1 | MH99 | TROP1 | TACST-1 | TACSTD1 | CD326 antigen | CO-17A | DIAR5 | EGP-2 | EGP314 | EGP40 | EPCAM | Epithelial glycoprotein 314 | HEA125 | Ly74 | M4S1
- UniProt Number
- P16422
- NCBI GenBank
- NM_002354 | NP_002345.2
- SwissProt
- P16422
Target
- Target
- Human EPCAM
- Antigen Species
- Human
- Epitope
- Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma. .
- Gene Name
- EPCAM
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189 aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen ami
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
