EnvR / ERV3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490609-100
Catalog Number: LS-C490609
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ERV3 antibody LS-C490609 is an unconjugated rabbit polyclonal antibody to human ERV3 (EnvR). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ERVR | EnvR | ERV-3 envelope protein | ERV-R envelope protein | ERV3 envelope protein | HERVR | H-plk | Envelope polyprotein | ERV-R | ERV3-1 | ERV3-1 envelope protein | ERV3 | HERV-R | HERV-R envelope protein
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- Q14264
- NCBI GenBank
- NP_001007254.2
- SwissProt
- Q14264
Target
- Target
- Human EnvR / ERV3
- Antigen Species
- Human
- Gene Name
- ERV3-1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids LELDDEGKVIKEITAKIQKLAHIPVQTWKG of human ERV3 were used as the immunogen for the ERV3 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS