ERV31 antibody Western blot. All lanes: Anti ERV31 at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: 22RV1 Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Lane 4: SKOV Whole Cell Lysate at 40 ug. Lane 5: A431 Whole Cell Lysate at 40 ug. Lane 6: HT1080 Whole Cell Lysate at 40 ug. Predicted band size: 68 kD. Observed band size: 68 kD.
EnvR / ERV3 Antibody (aa575-604)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408147-100
Catalog Number: LS-C408147
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ERV3 antibody LS-C408147 is an unconjugated rabbit polyclonal antibody to human ERV3 (EnvR) (aa575-604). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ERVR | EnvR | ERV-3 envelope protein | ERV-R envelope protein | ERV3 envelope protein | HERVR | H-plk | Envelope polyprotein | ERV-R | ERV3-1 | ERV3-1 envelope protein | ERV3 | HERV-R | HERV-R envelope protein
- UniProt Number
- Q14264
- NCBI GenBank
- NP_001007254.2
- SwissProt
- Q14264
Target
- Target
- Human EnvR / ERV3
- Antigen Species
- Human
- Epitope
- Expressed at higher level in adrenal, sebaceous glands and placenta. Expressed at lower level in bone marrow, brain, breast, colon, heart, kidney, liver, lung, ovary, PBL, prostate, skin, spleen, testis, thymus, thyroid, trachea. .
- Gene Name
- ERV3-1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ERV31 (575-604 aa LELDDEGKVIKEITAKIQKLAHIPVQTWKG).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl