
EMD / Emerin Antibody (DY550)
Primary AntibodyLSBio Guarantee
| Antibody: | Mouse Monoclonal |
| Applications: | Flow Cytometry |
| Reactivity: | Human |
| Format: | Liquid |
$583.00each
Catalog Number: LS-C756633-226
Catalog Number: LS-C756633
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Emerin antibody LS-C756633 is a DY550-conjugated mouse monoclonal antibody to human Emerin (EMD). Validated for Flow.
- Application
- FC
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Monoclonal Antibodies
- Alternative Names
- EDMD | EMD | Emerin | LEM domain containing 5 | LEMD5 | STA
- Recommended Dilution: FC
- 1 - 3 µg/10E6 cells
- UniProt Number
- P50402
- NCBI GenBank
- NM_000117 | NP_000108.1
- SwissProt
- P50402
Target
- Target
- Human EMD / Emerin
- Antigen Species
- Human
- Epitope
- No cross reactivity with other proteins.
- Gene Name
- EMD
Antibody
- Host Species
- Mouse
- Clonality
- Monoclonal
- Isotype
- IgG1
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Emerin (1-48 aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- DyLight 550
- Format
- Liquid
- Formulation
- 0.2% Na2HPO40.9% NaCl, 0.02% sodium azide, 50% glycerol
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at 4°C. Do not freeze. Protect from light.
- Recommended Storage Buffer
- NaCl
