Western Blot: MUC1 Antibody - TGF-beta1 cells, Antibody Titration: 0.2-1 ug/ml

EMA / MUC1 Antibody (aa1192-1241)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunocytochemistry, Immunofluorescence, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Bovine, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Format:	Liquid

$394.00each

Catalog Number: LS-C364616-0.1

Unit Size

Quantity

For bulk orders or custom formulations:

Description: MUC1 antibody LS-C364616 is an unconjugated rabbit polyclonal antibody to MUC1 (EMA) (aa1192-1241) from human. It is reactive with human, mouse, rat and other species. Validated for ICC, IF, IHC and WB.
Application: ICC, IF, IHC, IHC-P, WB
Reactivity: Bov, GP, Hr, Hu, Ms, Por, Rb, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: CA15-3 | CD227 | Carcinoma-associated mucin | CD227 antigen | DF3 antigen | Episialin | Epithelial membrane antigen | H23 antigen | H23AG | Krebs von den Lungen-6 | MAM6 | MUC1/ZD | MUC-1/SEC | Mucin-1 | Pem | KL-6 | MUC-1/X | MUC1 | Tumor-associated mucin | Peanut-reactive urinary mucin | Polymorphic epithelial mucin | PUM | EMA | MUC-1 | Mucin 1, transmembrane
Recommended Dilution: IF/ICC: 1:10 - 1:500
UniProt Number: P15941
NCBI GenBank: NM_002456 | NP_002447.4
SwissProt: P15941

Immunogen: Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C-Terminus of MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
Immunogen Type: Synthetic Peptide (Linear)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at: technical@vectorlabs.com.