
Western blot testing of human 1) T-47D, 2) A549 and 3) Caco-2 lysate with ELAVL2 antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa.
ELAVL2 / HUB Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782211-100
Catalog Number: LS-C782211
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- HUB antibody LS-C782211 is an unconjugated rabbit polyclonal antibody to HUB (ELAVL2) from human. It is reactive with human and mouse. Validated for IHC and WB.
- Application
- IHC-P, WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ELAV-like neuronal protein 1 | ELAV-like protein 2 | HEL-N1 | HELN1 | HUB | ELAVL2 | Hu-antigen B
- UniProt Number
- Q12926
- NCBI GenBank
- NM_004432 | NP_004423.2
- SwissProt
- Q12926
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC-P | 1 - 2 µg/ml |
| WB | 0.5 - 1 µg/ml |
Target
- Target
- Human ELAVL2 / HUB
- Antigen Species
- Human
- Gene Name
- ELAVL2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK were used as the immunogen for the ELAVL2 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- 1X PBS
