
Western blot analysis of K562 cell lysate.
EIF4EBP1 / 4EBP1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C331391-20
Catalog Number: LS-C331391
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- 4EBP1 antibody LS-C331391 is an unconjugated rabbit polyclonal antibody to 4EBP1 (EIF4EBP1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- 4E-BP1 | 4EBP1 | BP-1 | EIF4EBP1 | PHAS-I | EIF4E-binding protein 1
- UniProt Number
- Q13541
- NCBI GenBank
- NM_004095 | NP_004086.1
- SwissProt
- Q13541
Recommended Dilution
| Application | Dilution |
|---|---|
| IHC | 1:50 - 1:200 |
| WB | 1:500 - 1:2000 |
Target
- Target
- Human EIF4EBP1 / 4EBP1
- Antigen Species
- Human
- Epitope
- Human EIF4EBP1 / 4EBP1
- Gene Name
- EIF4EBP1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human EIF4EBP1 (NP_004086.1). TRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
