EIF2AK2 / PKR Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490476-100
Catalog Number: LS-C490476
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PKR antibody LS-C490476 is an unconjugated rabbit polyclonal antibody to human PKR (EIF2AK2). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EIF2AK2 | p1/eIF-2A protein kinase | p68 kinase | PRKR | EIF-2A protein kinase 2 | p68 | Protein kinase RNA-activated | Tik
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- P19525
- NCBI GenBank
- NM_002759 | NP_002750.1
- SwissProt
- P19525
Target
- Target
- Human EIF2AK2 / PKR
- Antigen Species
- Human
- Gene Name
- EIF2AK2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids EKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC of human PKR were used as the immunogen for the PKR antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS