PKR antibody Western blot. All lanes: Anti PKR at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Predicted band size: 69 kD. Observed band size: 69 kD.
EIF2AK2 / PKR Antibody (aa511-551)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408015-100
Catalog Number: LS-C408015
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- PKR antibody LS-C408015 is an unconjugated rabbit polyclonal antibody to human PKR (EIF2AK2) (aa511-551). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EIF2AK2 | p1/eIF-2A protein kinase | p68 kinase | PRKR | EIF-2A protein kinase 2 | p68 | Protein kinase RNA-activated | Tik
- UniProt Number
- P19525
- NCBI GenBank
- NM_002759, NP_002750.1
- SwissProt
- P19525
Target
- Target
- Human EIF2AK2 / PKR
- Antigen Species
- Hu
- Epitope
- Highly expressed in thymus, spleen and bone marrow compared to non-hematopoietic tissues such as small intestine, liver, or kidney tissues. Colocalizes with GSK3B and TAU in the Alzheimer disease (AD) brain. Elevated levels seen in breast and colon carcinomas,and which correlates with tumor progression and invasiveness or risk of progression. .
- Gene Name
- EIF2AK2
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human PKR(511-551 aa EKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by thirteen amino acid
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl