Western blot analysis of extracts of various cells.
EDNRB / Endothelin B Receptor Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Mouse |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C335279-20
Catalog Number: LS-C335279
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Endothelin B Receptor antibody LS-C335279 is an unconjugated rabbit polyclonal antibody to Endothelin B Receptor (EDNRB) from human. It is reactive with human and mouse. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Ms
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- ABCDS | Endothelin B receptor | EDNRB | Etb receptor | ET-B | Et-b receptor | Et-b-r | ET-RB | ETBR | ETRB | Etb-svr | WS4A | Endothelin receptor type B | ET-BR | ETB | HSCR | HSCR2
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P24530
- NCBI GenBank
- NM_000115 | NP_000106.1
- SwissProt
- P24530
Target
- Target
- Human EDNRB / Endothelin B Receptor
- Antigen Species
- Human
- Epitope
- Human EDNRB / Endothelin B Receptor
- Gene Name
- EDNRB
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EDNRB (NP_001116131.1). MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETF
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS